Anti-ADNP

Catalog Number: ATA-HPA006371
Article Name: Anti-ADNP
Biozol Catalog Number: ATA-HPA006371
Supplier Catalog Number: HPA006371
Alternative Catalog Number: ATA-HPA006371-100,ATA-HPA006371-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADNP1, KIAA0784
activity-dependent neuroprotector homeobox
Anti-ADNP
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 23394
UniProt: Q9H2P0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQDDVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQGDREQLKWKNSSYGKVEG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ADNP
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human stomach shows strong nuclear and moderate cytoplasmic positivity in glandular cells.
Western blot analysis in human cell line SH-SY5Y.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA006371-100ul
HPA006371-100ul
HPA006371-100ul