Anti-PLIN3
Catalog Number:
ATA-HPA006427
- Images (8)
| Article Name: | Anti-PLIN3 |
| Biozol Catalog Number: | ATA-HPA006427 |
| Supplier Catalog Number: | HPA006427 |
| Alternative Catalog Number: | ATA-HPA006427-100,ATA-HPA006427-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | M6PRBP1, PP17, TIP47 |
| perilipin 3 |
| Anti-PLIN3 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 10226 |
| UniProt: | O60664 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQVEDLQATFSSIHS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLIN3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to lipid droplets. |
|
|
Immunohistochemical staining of human small intestine shows strong nuclear and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell line U-87 MG. |
|
|
HPA006427-100ul |
|
|
|
|
|
|
|
|
HPA006427-100ul |
|
|
HPA006427-100ul |
Product Guarantee and Expert Support
