Anti-TAF6
Catalog Number:
ATA-HPA006566
- Images (8)
| Article Name: | Anti-TAF6 |
| Biozol Catalog Number: | ATA-HPA006566 |
| Supplier Catalog Number: | HPA006566 |
| Alternative Catalog Number: | ATA-HPA006566-100,ATA-HPA006566-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGC:8964, TAF2E, TAFII70, TAFII80, TAFII85 |
| TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa |
| Anti-TAF6 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 6878 |
| UniProt: | P49848 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TAF6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) |
|
|
HPA006566-100ul |
|
|
|
|
|
|
|
|
HPA006566-100ul |
|
|
HPA006566-100ul |
Product Guarantee and Expert Support
