Anti-PNKP Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA006782
Article Name: Anti-PNKP Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA006782
Supplier Catalog Number: HPA006782
Alternative Catalog Number: ATA-HPA006782-100,ATA-HPA006782-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PNK
polynucleotide kinase 3-phosphatase
Anti-PNKP
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 11284
UniProt: Q96T60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRMRKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PNKP
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Western blot analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PNKP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in human cell line HEK 293.
HPA006782
HPA006782
HPA006782