Anti-LAMTOR5

Catalog Number: ATA-HPA006812
Article Name: Anti-LAMTOR5
Biozol Catalog Number: ATA-HPA006812
Supplier Catalog Number: HPA006812
Alternative Catalog Number: ATA-HPA006812-100,ATA-HPA006812-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HBXIP, MGC71071, XIP
late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
Clonality: Polyclonal
Isotype: IgG
NCBI: 10542
UniProt: None
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHD
Target: LAMTOR5
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
HPA006812-100ul