Anti-TSPAN13
Catalog Number:
ATA-HPA007426
- Images (8)
| Article Name: | Anti-TSPAN13 |
| Biozol Catalog Number: | ATA-HPA007426 |
| Supplier Catalog Number: | HPA007426 |
| Alternative Catalog Number: | ATA-HPA007426-100,ATA-HPA007426-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NET-6, TM4SF13 |
| tetraspanin 13 |
| Anti-TSPAN13 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 27075 |
| UniProt: | O95857 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TSPAN13 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus. |
|
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human small intestine shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no membranous positivity in striated muscle fibers as expected. |
|
|
HPA007426-100ul |
|
|
|
|
|
HPA007426-100ul |
|
|
HPA007426-100ul |
Product Guarantee and Expert Support
