Anti-ROCK2
Catalog Number:
ATA-HPA007459
- Images (8)
| Article Name: | Anti-ROCK2 |
| Biozol Catalog Number: | ATA-HPA007459 |
| Supplier Catalog Number: | HPA007459 |
| Alternative Catalog Number: | ATA-HPA007459-100,ATA-HPA007459-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ROCK2 |
| Rho-associated, coiled-coil containing protein kinase 2 |
| Anti-ROCK2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9475 |
| UniProt: | O75116 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ROCK2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis using Anti-ROCK2 antibody HPA007459 (A) shows similar pattern to independent antibody HPA044109 (B). |
|
|
Western blot analysis in human cell line RH-30. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA007459-100ul |
|
|
|
|
|
HPA007459-100ul |
|
|
HPA007459-100ul |
Product Guarantee and Expert Support
