Anti-ILF2
Catalog Number:
ATA-HPA007484
- Images (8)
| Article Name: | Anti-ILF2 |
| Biozol Catalog Number: | ATA-HPA007484 |
| Supplier Catalog Number: | HPA007484 |
| Alternative Catalog Number: | ATA-HPA007484-100,ATA-HPA007484-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NF45 |
| interleukin enhancer binding factor 2 |
| Anti-ILF2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 3608 |
| UniProt: | Q12905 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ILF2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells. |
|
|
Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ILF2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis in human cell line HEK 293. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA007484-100ul |
|
|
HPA007484-100ul |
|
|
HPA007484-100ul |
Product Guarantee and Expert Support
