Anti-NFIX

Catalog Number: ATA-HPA007533
Article Name: Anti-NFIX
Biozol Catalog Number: ATA-HPA007533
Supplier Catalog Number: HPA007533
Alternative Catalog Number: ATA-HPA007533-100,ATA-HPA007533-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NF1A
nuclear factor I/X (CCAAT-binding transcription factor)
Anti-NFIX
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 4784
UniProt: None
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQHSQRQAPPLPTGLSASD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NFIX
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human skeletal muscle shows nuclear positivity in myocytes.
Western blot analysis in human cell line RT-4.
HPA007533-100ul
HPA007533-100ul
HPA007533-100ul