Anti-ABCA3

Catalog Number: ATA-HPA007884
Article Name: Anti-ABCA3
Biozol Catalog Number: ATA-HPA007884
Supplier Catalog Number: HPA007884
Alternative Catalog Number: ATA-HPA007884-100,ATA-HPA007884-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ABC-C, ABC3, EST111653, LBM180
ATP-binding cassette, sub-family A (ABC1), member 3
Anti-ABCA3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 21
UniProt: Q99758
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ABCA3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & cytosol.
Immunohistochemistry analysis in human lung and liver tissues using HPA007884 antibody. Corresponding ABCA3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lung shows strong positivity in pneumocytes.
Immunohistochemical staining of human cerebellum shows positivity in Purkinje cells.
Immunohistochemical staining of human liver shows weak cytoplasmic positivity in hepatocytes.
HPA007884-100ul
HPA007884-100ul
HPA007884-100ul