Anti-MGRN1

Catalog Number: ATA-HPA008033
Article Name: Anti-MGRN1
Biozol Catalog Number: ATA-HPA008033
Supplier Catalog Number: HPA008033
Alternative Catalog Number: ATA-HPA008033-100,ATA-HPA008033-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0544, RNF156
Clonality: Polyclonal
Isotype: IgG
NCBI: 23295
UniProt: O60291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHDEHSNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGISDGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDE
Target: MGRN1
Antibody Type: Monoclonal Antibody
HPA008033-100ul