Anti-SLC6A17

Catalog Number: ATA-HPA008043
Article Name: Anti-SLC6A17
Biozol Catalog Number: ATA-HPA008043
Supplier Catalog Number: HPA008043
Alternative Catalog Number: ATA-HPA008043-100,ATA-HPA008043-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 388662
UniProt: Q9H1V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL
Target: SLC6A17
Antibody Type: Monoclonal Antibody
HPA008043-100ul