Anti-TRIO
Catalog Number:
ATA-HPA008157
- Images (8)
| Article Name: | Anti-TRIO |
| Biozol Catalog Number: | ATA-HPA008157 |
| Supplier Catalog Number: | HPA008157 |
| Alternative Catalog Number: | ATA-HPA008157-100,ATA-HPA008157-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ARHGEF23 |
| trio Rho guanine nucleotide exchange factor |
| Anti-TRIO |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 7204 |
| UniProt: | O75962 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TRIO |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA008157 antibody. Corresponding TRIO RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes. |
|
|
HPA008157-100ul |
|
|
HPA008157-100ul |
|
|
HPA008157-100ul |
Product Guarantee and Expert Support
