Anti-EPHB3
Catalog Number:
ATA-HPA008184
- Images (8)
| Article Name: | Anti-EPHB3 |
| Biozol Catalog Number: | ATA-HPA008184 |
| Supplier Catalog Number: | HPA008184 |
| Alternative Catalog Number: | ATA-HPA008184-100,ATA-HPA008184-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ETK2, Hek2, Tyro6 |
| EPH receptor B3 |
| Anti-EPHB3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 2049 |
| UniProt: | P54753 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGPCLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSEPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | EPHB3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-EPHB3 antibody. Corresponding EPHB3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and EPHB3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401410). |
|
|
HPA008184-100ul |
|
|
|
|
|
HPA008184-100ul |
|
|
HPA008184-100ul |
Product Guarantee and Expert Support
