Anti-HMCN1

Catalog Number: ATA-HPA008220
Article Name: Anti-HMCN1
Biozol Catalog Number: ATA-HPA008220
Supplier Catalog Number: HPA008220
Alternative Catalog Number: ATA-HPA008220-100,ATA-HPA008220-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARMD1, FBLN6, FIBL-6, FIBL6
Clonality: Polyclonal
Isotype: IgG
NCBI: 83872
UniProt: Q96RW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYAIPSASLSWYKDGQPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDVNIQVPPSFQK
Target: HMCN1
Antibody Type: Monoclonal Antibody
HPA008220-100ul