Anti-RPN2

Catalog Number: ATA-HPA008297
Article Name: Anti-RPN2
Biozol Catalog Number: ATA-HPA008297
Supplier Catalog Number: HPA008297
Alternative Catalog Number: ATA-HPA008297-100,ATA-HPA008297-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RIBIIR, RPN-II, RPNII, SWP1
ribophorin II
Anti-RPN2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 6185
UniProt: P04844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RPN2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human epididymis and skeletal muscle tissues using Anti-RPN2 antibody. Corresponding RPN2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human epididymis shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA008297-100ul
HPA008297-100ul
HPA008297-100ul