Anti-RORB

Catalog Number: ATA-HPA008393
Article Name: Anti-RORB
Biozol Catalog Number: ATA-HPA008393
Supplier Catalog Number: HPA008393
Alternative Catalog Number: ATA-HPA008393-100,ATA-HPA008393-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NR1F2, ROR-BETA, RZRB
Clonality: Polyclonal
NCBI: 6096
UniProt: Q92753
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QRDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLE
Target: RORB
HPA008393-100ul