Anti-PGR Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PGR Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA008428
• Supplier Catalog Number: HPA008428
• Alternative Catalog Number: ATA-HPA008428-100,ATA-HPA008428-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: NR3C3, PR

Product Description

progesterone receptor

Additional Information

Anti-PGR

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 5241
• UniProt: P06401
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PGR
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemistry analysis in human endometrium and testis tissues using Anti-PGR antibody. Corresponding PGR RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, endometrium, fallopian tube and testis using Anti-PGR antibody HPA008428 (A) shows similar protein distribution across tissues to independent antibody HPA004751 (B).

Immunohistochemical staining of human testis shows low expression as expected.

Immunohistochemical staining of human endometrium shows high expression.

Immunohistochemical staining of human fallopian tube using Anti-PGR antibody HPA008428.

Immunohistochemical staining of human cerebral cortex using Anti-PGR antibody HPA008428.

HPA008428

HPA008428

HPA008428