Anti-PGR

Catalog Number: ATA-HPA008428
Article Name: Anti-PGR
Biozol Catalog Number: ATA-HPA008428
Supplier Catalog Number: HPA008428
Alternative Catalog Number: ATA-HPA008428-100,ATA-HPA008428-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NR3C3, PR
progesterone receptor
Anti-PGR
Clonality: Polyclonal
Isotype: IgG
NCBI: 5241
UniProt: P06401
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PGR
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human endometrium and testis tissues using Anti-PGR antibody. Corresponding PGR RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, endometrium, fallopian tube and testis using Anti-PGR antibody HPA008428 (A) shows similar protein distribution across tissues to independent antibody HPA004751 (B).
Immunohistochemical staining of human testis shows low expression as expected.
Immunohistochemical staining of human endometrium shows high expression.
Immunohistochemical staining of human fallopian tube using Anti-PGR antibody HPA008428.
Immunohistochemical staining of human cerebral cortex using Anti-PGR antibody HPA008428.
HPA008428-100ul
HPA008428-100ul
HPA008428-100ul