Anti-TMEM9

Catalog Number: ATA-HPA008483
Article Name: Anti-TMEM9
Biozol Catalog Number: ATA-HPA008483
Supplier Catalog Number: HPA008483
Alternative Catalog Number: ATA-HPA008483-100,ATA-HPA008483-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TMEM9A
Clonality: Polyclonal
Isotype: IgG
NCBI: 252839
UniProt: Q9P0T7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NKSSEDIRCKCICPPYRNISGHIYNQNVSQKDCNCLHVVEPMPVPGHDVEAY
Target: TMEM9
Antibody Type: Monoclonal Antibody
HPA008483-100ul