Anti-RING1

Catalog Number: ATA-HPA008701
Article Name: Anti-RING1
Biozol Catalog Number: ATA-HPA008701
Supplier Catalog Number: HPA008701
Alternative Catalog Number: ATA-HPA008701-100,ATA-HPA008701-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RNF1
ring finger protein 1
Anti-RING1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 6015
UniProt: Q06587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RING1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human nasopharynx shows strong nuclear and moderate cytoplasmic positivity in respiratory epithelial cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and RING1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401023).
HPA008701-100ul
HPA008701-100ul
HPA008701-100ul