Anti-PTPRH

Catalog Number: ATA-HPA008708
Article Name: Anti-PTPRH
Biozol Catalog Number: ATA-HPA008708
Supplier Catalog Number: HPA008708
Alternative Catalog Number: ATA-HPA008708-100,ATA-HPA008708-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SAP-1
Clonality: Polyclonal
Concentration: 0,05
NCBI: 5794
UniProt: Q9HD43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QANWVNQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLCASTYPDTVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEVGGQRGSQDRSSCGEAVSVLGLGPARSYPATITTIWDGMKVVSHSVVC
Target: PTPRH
HPA008708-100ul