Anti-RNF14

Catalog Number: ATA-HPA008716
Article Name: Anti-RNF14
Biozol Catalog Number: ATA-HPA008716
Supplier Catalog Number: HPA008716
Alternative Catalog Number: ATA-HPA008716-100,ATA-HPA008716-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARA54, HFB30, TRIAD2
ring finger protein 14
Anti-RNF14
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 9604
UniProt: Q9UBS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RNF14
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western blot analysis in human cell line A-549.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA008716-100ul
HPA008716-100ul
HPA008716-100ul