Anti-THAP12 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA008758
Article Name: Anti-THAP12 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA008758
Supplier Catalog Number: HPA008758
Alternative Catalog Number: ATA-HPA008758-100,ATA-HPA008758-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DAP4, P52rIPK, PRKRIR, THAP0
THAP domain containing 12
Anti-THAP12
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5612
UniProt: O43422
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: THAP12
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA008758
HPA008758
HPA008758
HPA008758
HPA008758