Anti-FANCF

Catalog Number: ATA-HPA008899
Article Name: Anti-FANCF
Biozol Catalog Number: ATA-HPA008899
Supplier Catalog Number: HPA008899
Alternative Catalog Number: ATA-HPA008899-100,ATA-HPA008899-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FAF
Clonality: Polyclonal
Isotype: IgG
NCBI: 2188
UniProt: Q9NPI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFR
Target: FANCF
Antibody Type: Monoclonal Antibody
HPA008899-100ul