Anti-FLII

Catalog Number: ATA-HPA008903
Article Name: Anti-FLII
Biozol Catalog Number: ATA-HPA008903
Supplier Catalog Number: HPA008903
Alternative Catalog Number: ATA-HPA008903-100,ATA-HPA008903-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLI, Fli1, FLIL, MGC39265
flightless I homolog (Drosophila)
Anti-FLII
Clonality: Polyclonal
Isotype: IgG
NCBI: 2314
UniProt: Q13045
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FLII
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA008903-100ul
HPA008903-100ul
HPA008903-100ul