Anti-NUAK2
Catalog Number:
ATA-HPA008958
- Images (7)
| Article Name: | Anti-NUAK2 |
| Biozol Catalog Number: | ATA-HPA008958 |
| Supplier Catalog Number: | HPA008958 |
| Alternative Catalog Number: | ATA-HPA008958-100,ATA-HPA008958-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ90349, SNARK |
| NUAK family, SNF1-like kinase, 2 |
| Anti-NUAK2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 81788 |
| UniProt: | Q9H093 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NUAK2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center & cytosol. |
|
|
Immunohistochemical staining of human vulva/anal skin shows strong nuclear positivity in squamous epithelial cells. |
|
|
HPA008958-100ul |
|
|
|
|
|
|
|
|
HPA008958-100ul |
|
|
HPA008958-100ul |
Product Guarantee and Expert Support
