Anti-ADGRA2

Catalog Number: ATA-HPA008984
Article Name: Anti-ADGRA2
Biozol Catalog Number: ATA-HPA008984
Supplier Catalog Number: HPA008984
Alternative Catalog Number: ATA-HPA008984-100,ATA-HPA008984-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp434C211, DKFZp434J0911, FLJ14390, GPR124, KIAA1531, TEM5
Clonality: Polyclonal
Concentration: 0,05
NCBI: 25960
UniProt: Q96PE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LLRLNISGNIFSSLQPGVFDELPALKVVDLGTEFLTCDCHLRWLLPWAQNRSLQLSEHTLCAYPSALHAQALGSLQEAQLCCEGALELHTHHLIPSLRQVVFQGDRLPFQCSAS
Target: ADGRA2
HPA008984-100ul