Anti-SLC27A6
Catalog Number:
ATA-HPA008987
- Images (7)
| Article Name: | Anti-SLC27A6 |
| Biozol Catalog Number: | ATA-HPA008987 |
| Supplier Catalog Number: | HPA008987 |
| Alternative Catalog Number: | ATA-HPA008987-100,ATA-HPA008987-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ACSVL2, FACVL2, FATP6, VLCS-H1 |
| solute carrier family 27 (fatty acid transporter), member 6 |
| Anti-SLC27A6 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 28965 |
| UniProt: | Q9Y2P4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LGTVEEILPSLSENISVWGMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC27A6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SH-SY5Y shows localization to nuclear bodies. |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SLC27A6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402279). |
|
|
HPA008987-100ul |
|
|
|
|
|
HPA008987-100ul |
|
|
HPA008987-100ul |
Product Guarantee and Expert Support
