Anti-FAM213A
Catalog Number:
ATA-HPA009025
- Images (8)
| Article Name: | Anti-FAM213A |
| Biozol Catalog Number: | ATA-HPA009025 |
| Supplier Catalog Number: | HPA009025 |
| Alternative Catalog Number: | ATA-HPA009025-100,ATA-HPA009025-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C10orf58, MGC4248, PAMM |
| family with sequence similarity 213, member A |
| Anti-FAM213A |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 84293 |
| UniProt: | Q9BRX8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FAM213A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human breast shows strong cytoplasmic positivity in adipocytes. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and PC-3 using Anti-FAM213A antibody. Corresponding FAM213A RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA009025-100ul |
|
|
HPA009025 |
|
|
HPA009025 |
|
|
HPA009025-100ul |
|
|
HPA009025-100ul |
Product Guarantee and Expert Support
