Anti-PNPLA7
Catalog Number:
ATA-HPA009130
- Images (7)
| Article Name: | Anti-PNPLA7 |
| Biozol Catalog Number: | ATA-HPA009130 |
| Supplier Catalog Number: | HPA009130 |
| Alternative Catalog Number: | ATA-HPA009130-100,ATA-HPA009130-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C9orf111, FLJ31318, FLJ43070, FLJ44279, NTE-R1, NTEL1, RP11-48C7.2 |
| patatin-like phospholipase domain containing 7 |
| Anti-PNPLA7 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 375775 |
| UniProt: | Q6ZV29 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKPASAVLTCPNASFTDLAEIVSRIEPAKPAMVDDESDYQTEYEEELLDVPRDAYADFQSTSAQQGSDLEDESSLRHRHPSLAFPKLSE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PNPLA7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in peripheral ganglion. |
|
|
HPA009130-100ul |
|
|
HPA009130-100ul |
|
|
HPA009130-100ul |
Product Guarantee and Expert Support
