Anti-CDHR5
Catalog Number:
ATA-HPA009173
- Images (7)
| Article Name: | Anti-CDHR5 |
| Biozol Catalog Number: | ATA-HPA009173 |
| Supplier Catalog Number: | HPA009173 |
| Alternative Catalog Number: | ATA-HPA009173-100,ATA-HPA009173-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ20219, MU-PCDH, MUCDHL, MUPCDH |
| cadherin-related family member 5 |
| Anti-CDHR5 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 53841 |
| UniProt: | Q9HBB8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFPFKTKEIRVEEDTKVNSTVIPETQLQAEDRDKDDILFYTLQEMTAGASDYFSLVS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CDHR5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human small intestine and cervix, uterine tissues using Anti-CDHR5 antibody. Corresponding CDHR5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Immunohistochemical staining of human cervix, uterine shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue. |
|
|
HPA009173-100ul |
|
|
HPA009173-100ul |
|
|
HPA009173-100ul |
Product Guarantee and Expert Support
