Anti-NT5C3A
Catalog Number:
ATA-HPA010520
| Article Name: |
Anti-NT5C3A |
| Biozol Catalog Number: |
ATA-HPA010520 |
| Supplier Catalog Number: |
HPA010520 |
| Alternative Catalog Number: |
ATA-HPA010520-100,ATA-HPA010520-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
cN-III, hUMP1, NT5C3, p36, P5N-1, PN-I, POMP, PSN1, UMPH, UMPH1 |
| Clonality: |
Polyclonal |
| Concentration: |
0,1 |
| NCBI: |
51251 |
| UniProt: |
Q9H0P0 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
FDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKI |
| Target: |
NT5C3A |
![]()
|
HPA010520-100ul |
