Anti-NT5C3A

Catalog Number: ATA-HPA010520
Article Name: Anti-NT5C3A
Biozol Catalog Number: ATA-HPA010520
Supplier Catalog Number: HPA010520
Alternative Catalog Number: ATA-HPA010520-100,ATA-HPA010520-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: cN-III, hUMP1, NT5C3, p36, P5N-1, PN-I, POMP, PSN1, UMPH, UMPH1
Clonality: Polyclonal
Concentration: 0,1
NCBI: 51251
UniProt: Q9H0P0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKI
Target: NT5C3A
HPA010520-100ul