Anti-CYB5R1
Catalog Number:
ATA-HPA010531
| Article Name: |
Anti-CYB5R1 |
| Biozol Catalog Number: |
ATA-HPA010531 |
| Supplier Catalog Number: |
HPA010531 |
| Alternative Catalog Number: |
ATA-HPA010531-100,ATA-HPA010531-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
humb5R2, NQO3A2 |
| Clonality: |
Polyclonal |
| Concentration: |
0,1 |
| NCBI: |
51706 |
| UniProt: |
Q9UHQ9 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
TLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEP |
| Target: |
CYB5R1 |
![]()
|
HPA010531-100ul |
