Anti-CD74 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA010592
Article Name: Anti-CD74 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA010592
Supplier Catalog Number: HPA010592
Alternative Catalog Number: ATA-HPA010592-100,ATA-HPA010592-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DHLAG
CD74 molecule, major histocompatibility complex, class II invariant chain
Anti-CD74
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 972
UniProt: P04233
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CD74
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human tonsil shows strong membranous and cytoplasmic positivity in germinal center cells and in non-germinal center cells.
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Western blot analysis in human cell line Daudi.
HPA010592
HPA010592
HPA010592