Anti-RHOT1
Catalog Number:
ATA-HPA010687
- Images (8)
| Article Name: | Anti-RHOT1 |
| Biozol Catalog Number: | ATA-HPA010687 |
| Supplier Catalog Number: | HPA010687 |
| Alternative Catalog Number: | ATA-HPA010687-100,ATA-HPA010687-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ARHT1, FLJ11040, MIRO-1 |
| ras homolog family member T1 |
| Anti-RHOT1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 55288 |
| UniProt: | Q8IXI2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RHOT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex shows positivity in neuronal cells. |
|
|
Immunohistochemical staining of human cerebellum shows positivity in neuronal cells. |
|
|
Immunohistochemical staining of human small intestine shows positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows positivity in hepatocytes. |
|
|
Immunohistochemical staining of human pancreas shows positivity in exocrine glandular cells. |
|
|
HPA010687-100ul |
|
|
HPA010687-100ul |
|
|
HPA010687-100ul |
Product Guarantee and Expert Support
