Anti-CDHR1

Catalog Number: ATA-HPA010795
Article Name: Anti-CDHR1
Biozol Catalog Number: ATA-HPA010795
Supplier Catalog Number: HPA010795
Alternative Catalog Number: ATA-HPA010795-100,ATA-HPA010795-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CORD15, KIAA1775, PCDH21, RP65
Clonality: Polyclonal
Concentration: 0,05
NCBI: 92211
UniProt: Q96JP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ATVPVTIRIVDLNNHPPTFYGESGPQNRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKVLTFKLLAVEVNTPEKFSSTADV
Target: CDHR1
HPA010795-100ul