Anti-GLG1

Catalog Number: ATA-HPA010815
Article Name: Anti-GLG1
Biozol Catalog Number: ATA-HPA010815
Supplier Catalog Number: HPA010815
Alternative Catalog Number: ATA-HPA010815-100,ATA-HPA010815-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CFR-1, ESL-1, MG-160
golgi glycoprotein 1
Anti-GLG1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 2734
UniProt: Q92896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMTSPSKNY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GLG1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemical staining of human placenta shows strong dot like cytoplasmic positivity in trophoblastic and decidual cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA010815-100ul
HPA010815-100ul
HPA010815-100ul