Anti-ALDH9A1
Catalog Number:
ATA-HPA010873
- Images (8)
| Article Name: | Anti-ALDH9A1 |
| Biozol Catalog Number: | ATA-HPA010873 |
| Supplier Catalog Number: | HPA010873 |
| Alternative Catalog Number: | ATA-HPA010873-100,ATA-HPA010873-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ALDH4, ALDH7, ALDH9, E3 |
| aldehyde dehydrogenase 9 family, member A1 |
| Anti-ALDH9A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 223 |
| UniProt: | P49189 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ALDH9A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA010873-100ul |
|
|
HPA010873 |
|
|
HPA010873 |
|
|
HPA010873-100ul |
|
|
HPA010873-100ul |
Product Guarantee and Expert Support
