Anti-DPYSL3 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA010948
Article Name: Anti-DPYSL3 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA010948
Supplier Catalog Number: HPA010948
Alternative Catalog Number: ATA-HPA010948-100,ATA-HPA010948-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CRMP4, DRP-3, ULIP
dihydropyrimidinase-like 3
Anti-DPYSL3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1809
UniProt: Q14195
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DPYSL3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.
Western blot analysis in human cell line NTERA-2.
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
HPA010948
HPA010948
HPA010948