Anti-CCDC126

Catalog Number: ATA-HPA010969
Article Name: Anti-CCDC126
Biozol Catalog Number: ATA-HPA010969
Supplier Catalog Number: HPA010969
Alternative Catalog Number: ATA-HPA010969-100,ATA-HPA010969-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ23031
Clonality: Polyclonal
Isotype: IgG
NCBI: 90693
UniProt: Q96EE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSI
Target: CCDC126
Antibody Type: Monoclonal Antibody
HPA010969-100ul