Anti-CDCP1
Catalog Number:
ATA-HPA010979
- Images (7)
| Article Name: | Anti-CDCP1 |
| Biozol Catalog Number: | ATA-HPA010979 |
| Supplier Catalog Number: | HPA010979 |
| Alternative Catalog Number: | ATA-HPA010979-100,ATA-HPA010979-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD318, SIMA135 |
| CUB domain containing protein 1 |
| Anti-CDCP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 64866 |
| UniProt: | Q9H5V8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GFSIANRSSIKRLCIIESVFEGEGSATLMSANYPEGFPEDELMTWQFVVPAHLRASVSFLNFNLSNCERKEERVEYYIPGSTTNPEVFKLEDKQPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQHPQNESNKIYVVDLSNERA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CDCP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human duodenum and lymph node tissues using HPA010979 antibody. Corresponding CDCP1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cervix shows weak to moderate membranous positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in non-germinal center cells as expected. |
|
|
Immunohistochemical staining of human duodenum shows strong membranous positivity in glandular cells. |
|
|
HPA010979-100ul |
|
|
HPA010979-100ul |
|
|
HPA010979-100ul |
Product Guarantee and Expert Support
