Anti-CENPE

Catalog Number: ATA-HPA011110
Article Name: Anti-CENPE
Biozol Catalog Number: ATA-HPA011110
Supplier Catalog Number: HPA011110
Alternative Catalog Number: ATA-HPA011110-100,ATA-HPA011110-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIF10, PPP1R61
Clonality: Polyclonal
Concentration: 0,05
NCBI: 1062
UniProt: Q02224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
Target: CENPE
HPA011110-100ul