Anti-CCDC90B Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CCDC90B Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA011130
• Supplier Catalog Number: HPA011130
• Alternative Catalog Number: ATA-HPA011130-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: MDS011, MDS025

Product Description

coiled-coil domain containing 90B

Additional Information

Anti-CCDC90B

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 60492
• UniProt: Q9GZT6
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: AHLDAIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CCDC90B
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity.

Western blot analysis using Anti-CCDC90B antibody HPA011130 (A) shows similar pattern to independent antibody HPA011931 (B).

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

HPA011130

HPA011130

HPA011130