Anti-CCDC90B Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA011130
Article Name: Anti-CCDC90B Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA011130
Supplier Catalog Number: HPA011130
Alternative Catalog Number: ATA-HPA011130-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MDS011, MDS025
coiled-coil domain containing 90B
Anti-CCDC90B
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 60492
UniProt: Q9GZT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AHLDAIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CCDC90B
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity.
Western blot analysis using Anti-CCDC90B antibody HPA011130 (A) shows similar pattern to independent antibody HPA011931 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA011130
HPA011130
HPA011130