Anti-NAPG

Catalog Number: ATA-HPA011389
Article Name: Anti-NAPG
Biozol Catalog Number: ATA-HPA011389
Supplier Catalog Number: HPA011389
Alternative Catalog Number: ATA-HPA011389-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NAPG
N-ethylmaleimide-sensitive factor attachment protein, gamma
Anti-NAPG
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 8774
UniProt: Q99747
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NAPG
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-NAPG antibody. Corresponding NAPG RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA011389-100ul
HPA011389-100ul
HPA011389-100ul