Anti-TCEAL9

Catalog Number: ATA-HPA011790
Article Name: Anti-TCEAL9
Biozol Catalog Number: ATA-HPA011790
Supplier Catalog Number: HPA011790
Alternative Catalog Number: ATA-HPA011790-100,ATA-HPA011790-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp313K1940, WBP5, WEX6
transcription elongation factor A like 9
Anti-TCEAL9
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 51186
UniProt: Q9UHQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TCEAL9
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human thyroid gland shows cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and WBP5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414074).
HPA011790-100ul
HPA011790-100ul
HPA011790-100ul