Anti-COL1A1
Catalog Number:
ATA-HPA011795
- Images (8)
| Article Name: | Anti-COL1A1 |
| Biozol Catalog Number: | ATA-HPA011795 |
| Supplier Catalog Number: | HPA011795 |
| Alternative Catalog Number: | ATA-HPA011795-100,ATA-HPA011795-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | OI4 |
| collagen, type I, alpha 1 |
| Anti-COL1A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1277 |
| UniProt: | P02452 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | COL1A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles. |
|
|
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in stromal cells. |
|
|
Immunohistochemical staining of human colorectal cancer shows strong strong cytoplasmic positivity in tumor cells. |
|
|
Immunohistochemical staining of human cervix shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
HPA011795-100ul |
|
|
|
|
|
HPA011795-100ul |
|
|
HPA011795-100ul |
Product Guarantee and Expert Support
