Anti-PDCD6IP Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PDCD6IP Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA011905
• Supplier Catalog Number: HPA011905
• Alternative Catalog Number: ATA-HPA011905-100,ATA-HPA011905-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: AIP1, Alix, Hp95

Product Description

programmed cell death 6 interacting protein

Additional Information

Anti-PDCD6IP

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 10015
• UniProt: Q8WUM4
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDND
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PDCD6IP
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Western blot analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDCD6IP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA011905

HPA011905

HPA011905