Anti-MAGEH1

Catalog Number: ATA-HPA011971
Article Name: Anti-MAGEH1
Biozol Catalog Number: ATA-HPA011971
Supplier Catalog Number: HPA011971
Alternative Catalog Number: ATA-HPA011971-100,ATA-HPA011971-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: APR1
Clonality: Polyclonal
Isotype: IgG
NCBI: 28986
UniProt: Q9H213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LGKLGMQPGRQHSIFGDPKKIVTEEFVRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILNSGARG
Target: MAGEH1
Antibody Type: Monoclonal Antibody
HPA011971-100ul