Anti-PDE9A

Catalog Number: ATA-HPA011978
Article Name: Anti-PDE9A
Biozol Catalog Number: ATA-HPA011978
Supplier Catalog Number: HPA011978
Alternative Catalog Number: ATA-HPA011978-100,ATA-HPA011978-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 5152
UniProt: O76083
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMF
Target: PDE9A
Antibody Type: Monoclonal Antibody
HPA011978-100ul