Anti-THRAP3

Catalog Number: ATA-HPA012041
Article Name: Anti-THRAP3
Biozol Catalog Number: ATA-HPA012041
Supplier Catalog Number: HPA012041
Alternative Catalog Number: ATA-HPA012041-100,ATA-HPA012041-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TRAP150
thyroid hormone receptor associated protein 3
Anti-THRAP3
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 9967
UniProt: Q9Y2W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ETEEREESTTGFDKSRLGTKDFVGPSERGGGRARGTFQFRARGRGWGRGNYSGNNNNNSNNDFQKRNREEEWDPEYTPKSKKYYLHDDREGEGSDKWVSRGRGRGAFPRGRGRFMFRKSSTSPKWAHDKFS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: THRAP3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles.
Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
HPA012041-100ul
HPA012041-100ul
HPA012041-100ul